<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-214336565 2143365651 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A L10F, T74P I62V, L63P, L89M  
>2143365651| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGPVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q G190A   D123E, G196S, R211T, L283I, I293V, E312Q, D324E, R356K, M357T, A376S, S379C, V381I, K390R  
>2143365651| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEISQHRTKIEELRQHLLTWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKQPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDVKQLTEAVQKISTECIIIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002