<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-537636817 5376368171 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S I15V, K20I, E35D, N37D, R57K, L63P, A71V, I72M, I93L  
>5376368171| codons 1-99
PQITLWQRPLVTIKVGGQLIEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVMSTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K20R, T69N, I135V, S162A, R211K, L228H, T286A, K347R, R356K, M357L, A360V, A376S, K390R  
>5376368171| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFRNLKTGKYAKLRGV
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004