<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-554136844 5541368441 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219E Y188L   V60I, K82R, R83K, V106L, V118VI, D123E, R172K, D177E, R211K, T286A, G333E, N348NT, G359S, A371V, K390R  
>5541368441| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNRKTQDFWEVQLGIPHPAGLKKKKSLTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPEIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKTLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47V, V82A K43T L10I, E35D, M36I, N37D, K55R, L63P, A71T  
>5541368441| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEDIDLPGRWTPKLVGGIGGFIRVRQYD
QIPIEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005