<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-340736685 3407366851 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I     K20R, V118I, I135T, T165I, E203D, R211K, E248D, V276I, A288S, I293V, I326V, G333E, Q334H, V365I, T377R, T386I, I393V, E399D C280S
>3407366851| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLSKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQEHGQWTYQIYQEPFKILKTGKYARMRGA
HTNDIKQLTEAVQKIARESIVIWGKIPKFKLPVQKETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36L, R57K, L63P, A71T, I72M  
>3407366851| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDLNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTMGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005