<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-335536593 3355365931 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y   K103N V108I K43N, E44D, D123E, D177E, E203K, Q207E, H208Y, R211K, K223E, L228H, V245T, A288T, Q334L, R358K, K390R, E399G  
>3355365931| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLLKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKTLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWGA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F L10I, K20R, E35D, M36I, N37D, R41K, D60E, I62V, L63A, A71V, I93L  
>3355365931| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGKWKPKMIGGIGGFVKVRQYE
QVAIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005