<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-348536843 3485368431 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, L90M G73S L10I, E35ED, K45R, K55R, I62V, L63P, K70R, A71V, I72E, I93L  
>3485368431| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPRIIGGIGGFIRVRQYD
QVPIEICGHRVESTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V V75I, K219Q     D121H, I135T, S162C, D177E, D218E, M230MR, V245E, G359S, T377M  
>3485368431| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWRGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002