<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74LI, M184V, L210W, T215Y D67G, V75VSLA, K219DE Y188YLHF, G190GS V179E K43KR, E44D, S68G, V90VI, V106VI, V118VI, I135V, I195IT, T200AE, K223E, F227FY, L228LH, Q242QH, A272S, K275Q, V276T, L283I, V292I, I293V, V317A, D324E, E344D, P345T, R356K, G359S, A376AS, T377M, K395R, E399D E203EDNK
>5574366201| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELERDGKISKIGPENPYNTPV
FAIKKKGGTRWRKISDFRELNKRTQDFWEIQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIEI
YQYVDDLLVSSDLETGQHRAKIDELRQHLWRWGFYTPDDKHQEEPPYHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIQTKQLCKLIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGQGQWTYQIYQDTFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKISMESIVIWGKTPKFKLPIQRETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73GS L10LI, T12TAVI, K14KR, N37NDEK, L63P, A71T, I72IV, V77VI  
>5574366201| codons 1-99
PQITLWQRPIVAIRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTVSTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005