<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-382436846 3824368461 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y N348I     V35T, T39A, K43E, R83K, V118VI, E203EK, Q207E, H208HY, R211K, E248D, E297K, I326V, Q334E, G359S, K366R  
>3824368461| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGEGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13IV, K20R, E35D, M36I, N37D, I62V, L63P, I64L  
>3824368461| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005