<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-245836636 2458366361 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N, Y188L   R83K, K102M, D123E, D177G, H208HY, R211K, V245E, K275R, Q278N, K281R, V292I, I293V, E297K, I329L, G335S, M357T, T386I, K390R  
>2458366361| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKMNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKNLCRLLRGTKALTEIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQSQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, R57K, L63P, C67E, H69Y  
>2458366361| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEIEGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005