<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V, L90M   L10I, I15V, K20R, M36I, L63P, V77VI  
>5328365571| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R K101KE, K103KN, G190AT A98G E6D, V35I, K43E, E44EA, V60I, K82R, R83K, V118I, I135IT, V189I, I202V, Q207E, V245Q, E297R, R356K, G359S, A360T, K390R  
>5328365571| codons 1-400
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNRKTQDFWEVQLGIPHPGGLEKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYIASDLEIGQHRTKVEELREHLWRWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRST
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002