<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-377036830 3770368301 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K14R, I15V, K20T, E35ED, M36I, N37D, I64V, K70KR, A71V R87RG
>3770368301| codons 1-99
PQITLWQRPLVTIRVGGQLTEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHRVIGTVLVGPTPVNIIGGDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV     V35I, I135T, I142V, G196E, T200K, I202V, R211G, V241VI, V245M, Q278E, I293IV, P294PT, E297R, R358RK, T369A, K390R V108VA
>3770368301| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTALDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRKKVEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVVTLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLAEAVQKIATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004