<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215F K219Q, N348I Y188L   V35I, T39A, K43KE, V60I, T69E, K102W, V118I, D123E, I178M, Q197QH, Q207A, H208HY, R211K, D218E, L228H, Q242H, V245T, A272AV, K277T, L283I, I293V, P294Q, E298A, I341F, R356K, A376S, T377R, K390R  
>2539367471| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKWKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLLVGSDLEIGHHRTKIEELRAYLWKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VHPITLPEKDSWTVNDIQKLVGKLNWASQIYVGIKVTQLCKLIRGTKALTEVVQLTEAAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQFYQEPFKILKTGKYAKMRGA
HTNDVKQLTEAVQKISRESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, R41K, L63P, I64V, K70R, V77I  
>2539367471| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005