<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-008-060-076 060-07621 South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 ATV+D4T+3TC 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L   T12S, I15V, L19I, K20R, E35D, M36I, R41K, H69K, L89M, I93L  
>060-07621| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGLGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004