<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-810024D 24D21 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV NA
2 NFV+ATV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I50L L10F, N88D I13V, N37S, R41K, I62V, L63P, K70R, A71T, I93L  
>24D21| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADNTVLEEMSLPGKWKPKMIGGLGGFIKVRQYD
QVPIEICGHRTIGTVLVGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004