<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-009-008-089 008-08921 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ NFV NA
2 RTI+ ATV+ SQV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, I84V L10F, L33I, F53L, N88D T12A, I13V, E35D, M36I, D60E, I62V, L63P, I66V, A71T, I85V, I93L  
>008-08921| codons 1-99
PQITLWQRPFVAVKIGGQLKEALLDTGADNTVIEDINLPGRWKPKMIGGIGGLLKVRQYE
QVPIEVCGHKTIGTVLVGPTPVNVVGRDLLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005