<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-009-014-023 014-02311 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, N88S   L10I, I13V, E35D, N37Y, R41K, L63Q, I64V, I72V, V77I, I85V  
>014-02311| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADNTVLEDMYLPGKWKPKIIGGIGGFIKVRQYD
QIQVEICGHKAVGTVLIGPTPVNIVGRSLLTQIGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005