<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-007-040-450 040-45021 Argentina 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 ATV+D4T+DDI 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L   L19I, R41K, A71V, T74S  
>040-45021| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGLGGFIKVRQYD
QILIEICGHKVIGSVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005