<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-008-061-188 061-18821 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 RTI+ NFV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, L19I, K20T, E35X, M36I, R57K, I62V, L63S, K70R, T74S, I93L  
>061-18821| codons 1-99
PQITLWQRPLVTIKVEGQITEALLDTGADDTVLEXINLPGRWKPKMIGGIGGFIKVKQYD
QVSIEICGHRAIGSVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005