<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI+ NFV NA
2 RTI+ ATV+ SQV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V L10F, N88D K20R, E35D, M36V, N37D, L63P, H69Y, K70E, A71V, V77I  
>012-01521| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADNTVLEDVDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYEVIGTVLIGPTPVNVIGRDLLTQIGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005