<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12792 12792 U.K. 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, A21T, I72V, T112V, I113V, T124A, T125A, G134N, K136Q, G163T, V201I, A205S, T206S, V260L, D278S V281M, S283G
>12792| codons 1-288
FLDGIDKAQEDHERYHSNWRTMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIITQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISSDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVLPRRKAKIIRDYGKQMAGSDCMAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, P39Q, R41K, L63P, V77I  
>12792| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEEMNLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, K43E, S48T, V60I, R78X, D121H, K122E, S162A, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, D250E, L283I, V292I, I293V, P294T, E297A, E312D, G335D, M357K, G359S, K366R, T369V, A371V, I375V, A376T, T377R, K390R, A400T, T403M, E404D, E432D, V435E, T470N, D471E, K476M, Q480H, Q509L, E516G, S519N, Q524K, K527E, E529D, A554S E29Q, G490R
>12792| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEQKIKALTEICADMEEEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFXELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEIVTLTAEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLVEVVQKVTRESIVIWGKTPKFRLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIEGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNETTNQMTELH
AIHLALQDSRLEVNIVTDSQYALGIIQALPDKSESGLVNQIIEKLIEKDKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Foster, GM Novel HIV-1 recombinants spreading across multiple risk groups in the United Kingdom: the identification and phylogeography of circulating recombinant form (CRF) 50_A1D. PLoS ONE, 2014