<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LE-11 LE11 Lebanon 1996 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, E35D, M36I, R41K, I64M, H69K, L89M, T91S I93H
>LE11| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLSQHGCTLNF

References
Author Title Citation
Pieniazek, D Evidence for the introduction of multiple HIV-1 subtypes in Lebanon. Emerg Infect Dis, 1998