<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, R41K, H69K, V77I, L89M, L97I  
>2112| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35I, E36N, I37F, T39E, V60I, R83K, K122E, D123S, I135IT, R172K, K173R, Q174K, D177E, I178M, Q207A, R211S, F214FL, K238R, V245K T58TA
>2112| codons 30-247
QIGCTINFCEEMEKEGKISKIGPENPYNAPIFAIKKKDSTKWRKLVDFRELNKKTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFKRKNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRAHL
LSWGLTTPDKKHQKEPPFLWMGYELHPDRWTVQPIKLP

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013