<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 ABC|APV|EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L10FI, L33F I13V, K20R, E35D, M36I, N37D, R41K, K45R, R57K, I62IV, H69K, L89M, I93V L24LV
>196| codons 4-99
TLWQRPIVTVKIGGQLREALVDTGADDTVFEDIDLPGKWKPRIIGGIGGFIKVKQYDQVL
IEICGKKAIGTVLVGPTPVNVIGRNMLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF, Q151M A62V, V75I, F77FL, F116Y K101EQ, K103KN, Y181C, G190A   T39TA, K49KR, E53ED, S68K, V106VI, V111VI, V118I, K122E, D123S, I135IT, K173S, Q174R, D177E, V179I, T200A, Q207A, R211RS, F214L, H221Y, F227FY, V245T W88WAGS
>196| codons 38-247
CAEMEKEGKISRIGPDNPYNTPVFVIKRKDKTKWRKLIDLRELNKRTQDFSEVQLGIPHP
AGLQKNKSITVLDIGDAFYSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRSRNPEIIICQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGLTTP
DKKYQKEPPYLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013