<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
989_MT 989_MT Israel 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10LF I13V, K20T, E35D, M36I, R41K, H69K, A71AV, T74S, L89I, I93L  
>989_MT| codons 4-99
TLWQRPFVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKVIGSVLVGPTPVNIIGRNIMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35L, E36N, I37F, T39N, K122E, D123NS, I135IMT, E138A, K173L, Q174K, D177DE, T200TI, I202V, Q207ADNT, R211RKNS Q145Q*
>989_MT| codons 35-247
LNFCNEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNATPGIRY*YNVLPQGWK
GSPAIFQSSMTKILEPFRLKNPEIVIYQYVDDLYVGSDLEIGQHRIKVEELRTHLLSWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013