<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1996_FT 1996_FT Israel 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I, P225H V35L, E36N, I37F, T39M, K122E, D123S, A158AS, K173L, Q174K, D177E, T200A, E203D, Q207A, R211S, V245M  
>1996_FT| codons 35-247
LNFCMEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKNKSVTILDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPSIFQSSMTKILEPFRLKNPEIVIYQYVDDLYVGSDLEIGQHRAKIDELRAHLLSWGF
TTPDKKHQKEHPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5LF, K14R, E35D, M36I, N37D, R41K, H69K, L89M, I93L  
>1996_FT| codons 4-99
TFWQRPLVTIRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013