<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1997_MT 1997_MT Israel 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|LPV|TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39N, T69N, K122E, D123N, K173A, Q174K, D177E, Q207A, R211S, L246V V241D
>1997_MT| codons 30-247
QIGCTLNFCNEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHL
LSWGFTTPDKKHQKEPPFLWMGYELHPDKWTDQPIVVP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, N37D, Q61E, L63V, I64M, H69K, L89M  
>1997_MT| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYDEIV
MEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013