<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|EFV|TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V   K101E, Y181C, G190S   K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39V, V106I, D121H, K122E, D123S, I135T, K173S, Q174K, D177E, T200A, Q207A, R211S, L228LR, V245M  
>1966_MT| codons 30-247
QIGCTLNFCVEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLEKKKSITVLDVGDAYFSVPLHESFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRSKNPEIVICQYVDDLYVSSDLEIGQHRAKIEELRAHL
LSWGFTTPDKKHQKEPPFRWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, M36I, N37D, R41K, H69K, K70R, L89M  
>1966_MT| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Avidor, B Transmission patterns of HIV-subtypes A/AE versus B: inferring risk-behavior trends and treatment-efficacy limitations from viral genotypic data obtained prior to and during antiretroviral therapy. PLoS ONE, 2013