<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+LPV NA
2 3TC+D4T+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82S   R41K, K55R, L63P, H69K, A71V, I93L  
>11ZAKS140| codons 39-99
PGKWKPKIIGGIGGFVRVRQYDQIPIEICGKKVIGTVVVGPTPSNIIGRNLLTQLGCTLN
F

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       V35T, E36A, T39E, K43R, I135V, S162C, K173A, Q174K, D177E, T200A, Q207E, V245Q, D250DN, A272P, E291D, V292I, I293V, P313S  
>11ZAKS140| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKNSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKESVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014