<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12ZAKS279 12ZAKS279 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   L100I, K103N   V35T, E36A, T39E, S48T, V60I, K122E, D123S, I135IL, T165I, K173T, I178M, T200A, Q207E, H221HY, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, D324DE, Q334H, G335D, R356K, M357R, G359T, K366R, T369V, A371AV, I375IV, T377L, K390R  
>12ZAKS279| codons 1-390
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVRQLVEVVQKVALESIVIWGKTPKFR

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014