<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12ZAKS365 12ZAKS365 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, T215F V75M, K219W, N348I Y181C V108I V8L, V21VI, V35IKLQ, E36EA, T39EK, K43Q, S48T, K49R, E53D, V60I, V90I, K101R, V118I, K122E, D123N, S162H, K173T, Q174K, D177E, T200A, E203D, Q207E, R211RK, K223Q, L228H, V245Q, R284RK, T286A, T290S, E291D, V292I, I293V, D324DE, Q334DN, G335D, R356K, M357R, G359S, A360T, T377R, K390KR, A400AITV, E404D  
>12ZAKS365| codons 1-434
PISPIETLPVKLKPGMDGPKIKQWPLTEEKIKALQAICKELEQEGKITRIGPDNPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEIQLGIPHPAGLRKKKSVTILDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIDELREHLLKWGFFTPDWKHQQEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALSDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGNDQWTYQIYQEPFKILKTGKYAKRRST
HTNDVKQLTEAVQKIARESIVIWGKTPKFRLPIQKETWEVWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPI

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014