<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
09ZAKS010 09ZAKS010 South Africa 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74LV, M184V K219KE K103KN, V106M V179VD, F227L K20R, V35T, E36EA, T39AE, S48T, V60I, D123E, I135IV, I142V, K173A, Q174K, D177E, T200A, Q207A, R211K, F214FL, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, L301F, I329L, Q334D, G335D  
>09ZAKS010| codons 1-341
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIDI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGLTTPDEKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
FELAENREILKEPVHGVYYDPSKDLIAELQKQGDDQWTYQI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, H69K, T74S, L89M, I93L  
>09ZAKS010| codons 39-99
PGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLN
F

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014