<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
09ZAKS012 09ZAKS012 South Africa 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA
2 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   L100LI, K103N   V35T, E36A, T39E, S48T, I50M, K102R, D121H, K122E, D123S, I135L, E138A, K173A, Q174K, D177G, T200A, I202V, Q207N, R211K, L228LR, V245Q G51E, I63FL, K64L, L260F
>09ZAKS012| codons 1-271
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKMEPENPYNTPV
FALLKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPGIVI
YQYVDDLYVGSDLEIGQHRAKVEELRNHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKFVGKLNWASQIY

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014