<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12ZAKS198 12ZAKS198 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I N348I K103N   T27S, I31L, V35T, E36A, T39E, S48T, K122E, D123G, E138A, S162C, K173A, Q174R, G196E, T200A, Q207E, R211K, D237N, V245Q, T286A, V292I, I293V, V317A, D324E, Q334N, G335D, R356K, G359T, T377I, K390R, A400T, E404N, K431T  
>12ZAKS198| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLSEEKLKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRARNPDIVI
YQYIDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPNKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGNDQWTYQIYQEPFKILKTGKYAKMRTA
HTNDVKQLTEAVQKIAIESIVIWGKTPKFRLPIQKETWETWWTNYWQATWIPEWEFVNTP
PLVKLWYQLETEPI

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014