<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11ZAKS163 11ZAKS163 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA
2 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   V106M, Y181C F227L V21I, K32R, V35T, T39E, S48T, K101I, K122E, T165L, K173A, D177E, T200A, I202V, E204K, Q207E, V245Q, A272P, K277T, T286A, E291D, V292I, I293V, D324E, Q334N, G335D  
>11ZAKS163| codons 1-345
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIRALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLIKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMLKILEPFRAQNPEIVI
CQYVDDLYVGSDLEIGQHRAKVEKLREHLLRWGFFTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVTQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGNDQWTYQIYQEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, K43R, L63P, H69K, I93L  
>11ZAKS163| codons 39-99
PGKWRPKMIGGIGGFIKVRQYDQIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLN
F

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014