<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   K103KNRS, V106M, G190A F227FL P4H, V35M, T39E, E53D, K64R, K102Q, K122E, S162D, K173T, Q174K, D177E, T200A, Q207E, R211K, V245K, I257L, A272P, E291D, V292I, I293V  
>10ZAKS056| codons 1-302
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICEEMEKEGKISKIGPDNPYNTPV
FAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKQSKSMTVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRTKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIKLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, Q61H, H69K, L89M, I93L  
>10ZAKS056| codons 39-99
PGKWKPKMIGGIGGFIKVRQYDHILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLN
F

References
Author Title Citation
Steegen, K High-level cross-resistance to didanosine observed in South African children failing an abacavir- or stavudine-based 1st-line regimen. PLoS ONE, 2014