<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
139899 139899 Portugal 2007 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+NVP 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V K219KN K103N, Y181C, G190A   V35T, K43KR, V60I, A98S, K122E, D123S, I135V, K173I, Q174K, D177E, T200E, Q207K, R211S, H221HY, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, L301M, D320E, D324E, I329V  
>139899| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAFFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVASDLEIGQHREKIEELRKHLLSWGFTTPDNKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYEPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13V, K14R, G17E, K20I, E35D, M36I, R41K, H69K, K70R, V82I, L89M  
>139899| codons 1-99
PQITLWQRPLVKVRIGEQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Theys, K Decreasing population selection rates of resistance mutation K65R over time in HIV-1 patients receiving combination therapy including tenofovir. J Antimicrob Chemother, 2013