<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BM24700 BM24700 Portugal 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, V106M, G190A   E6K, V35T, V60I, A98S, K122E, K173I, Q174K, D177E, I178M, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E, D324E, I329V  
>BM24700| codons 1-333
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLEKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, R57K, H69K, V82I, L89M  
>BM24700| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Theys, K Decreasing population selection rates of resistance mutation K65R over time in HIV-1 patients receiving combination therapy including tenofovir. J Antimicrob Chemother, 2013