<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3559 3559 Portugal 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F116Y, K219E L100I, K103N V108I S68G, T69I, R83K, V90I, K102KR, D123E, R172K, D177E, G196E, E204V, R211K, F214L, L228R  
>3559| codons 40-238
EMEKEGKISKIGPENPYNTPVFAIKRKDGIRWRKLIDFRELNKKTQDFWEIQLGIPHPAG
IKRNKSVTILDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAI
FQSSMTKILEPFKKQNPEIVIYQYMDDLYVGSDLEIEQHRTKIEVLRQHLLKWGLTTPDE
KHQKEPPFRWMGYELHPDK

References
Author Title Citation
Theys, K HIV-1 subtype is an independent predictor of reverse transcriptase mutation K65R in HIV-1 patients treated with combination antiretroviral therapy including tenofovir. AAC, 2013