<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215F V75VIM, K219Q   A98G V60I, D123E, I135K, I142IV, G196E, T200A, R211K  
>3920| codons 40-238
ELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPGG
LKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSKNNETPGVRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIEELRQHLLKWGFFTPDQ
KHQKEPPFLWMGYELHPDK

References
Author Title Citation
Theys, K HIV-1 subtype is an independent predictor of reverse transcriptase mutation K65R in HIV-1 patients treated with combination antiretroviral therapy including tenofovir. AAC, 2013