<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184I A62AV, D67Y, T215I, K219Q K103N, Y181YC V108VI, V179E K64N, S68T, V90I, K102Q, K122E, D123E, S162Y, T200A, D218E, L228F, D237DE T84TA
>25048| codons 40-238
EMEKEGKISKIGPENPYNTPVFVINKKYTTRWRKLVDFRELNKRAQDFWEIQLGIPHPAG
LKQNKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQYSMTKILEPFRKQNPDIEICQYIDDLYVGSDLEIGQHRAKIEELRQHLLRWGFITPEQ
KHQKEPPFFWMGYELHPEK

References
Author Title Citation
Theys, K HIV-1 subtype is an independent predictor of reverse transcriptase mutation K65R in HIV-1 patients treated with combination antiretroviral therapy including tenofovir. AAC, 2013