<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
56125 56125 Italy 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q G190A   I50V, V60I, K64Y, D123E, I135T, K166R, I178M, G196E  
>56125| codons 40-238
EMEKEGKISKVGPENPYNTPIFAIYKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTRILEPFRKQNPDMVIYQYMDDLYVASDLEIEQHRTKIEELRQHLLRWGFTTPDQ
KHQKEPPFLWMGYELHPDK

References
Author Title Citation
Theys, K HIV-1 subtype is an independent predictor of reverse transcriptase mutation K65R in HIV-1 patients treated with combination antiretroviral therapy including tenofovir. AAC, 2013