<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
150 150_135 Russia 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV+NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, H69K, L89M, I93L  
>150_135| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V Y181C   K11T, V35T, E36D, T39K, K49R, K82R, K122E, D123S, I135T, A158S, S162HN, K173L, Q174K, D177E, Q207A, R211S, V245T, E248D  
>150_135| codons 1-251
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTDICKEMEKEGKISRIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQNSMTKILEPFRLKNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDS

References
Author Title Citation
Kolomeets, AN A uniquely prevalent nonnucleoside reverse transcriptase inhibitor resistance mutation in Russian subtype A HIV-1 viruses. AIDS, 2014