<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1173 CA2666 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 283
2 DDI 113
3 3TC+AZT 22
4 3TC+AZT+SQV 57
5 3TC+D4T+IDV 30
6 3TC+D4T+RTV+SQV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, I72IV, V77I  
>CA2666| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QILIEICGHKAVGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     T27S, I31V, K64H, T69N, K122X, I195L, D218E, L228H, V245M, E248V, K249Q  
>CA2665| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLSEEKVKALVEICTEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DXDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLELGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIMLPVQDS

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005