<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1848 4675-1 U.S. 1998 HIV1 B Plasma MC

Treatment History
Order Regimen Weeks
1 D4T+ 3TC 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, L210W, T215Y K219R     E28K, K32E, R83K, K122E, S162Y, E169D, D177E, I178L, R211K, A272P R284RS
>4675-1| codons 1-328
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLSGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAE

References
Author Title Citation
Gonzales, MJ Colinearity of reverse transcriptase inhibitor resistance mutations detected by population-based sequencing. JAIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012