<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N L234LI I31L, V35T, T39KN, V106I, T107S, K122E, D123S, S162Y, K173A, Q174K, D177E, I178IL, Q207A, R211S, F214FL, L228R  
>U1215052| codons 16-239
MDGPKVKQWPLTEEKLKALTEICNEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKNKSISVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPELVIYQYVDDLYVGSDLEI
GQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFRWMGYEIHPDKW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013