<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1170 CA2658 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 17
2 3TC+AZT+IDV 61
3 3TC+D4T+IDV 30
4 3TC+DDC+NFV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L10F, N88T K14R, N37S, R41K, I62V, L63P, V77I, I93L  
>CA2658| codons 1-99
PQITLWQRPFVTIRIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRTLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219E     T69N, I135T, T200A, Q207E  
>CA2657| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFVTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVN

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005