<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
U0707056 U0707056 Cambodia 2010 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FY K219E Y181C A98G, K101H K20R, V35T, T39K, K43E, V60I, V118I, D121H, K122E, D123S, S162SN, K173I, Q174K, D177E, I178L, Q207A, R211S, F214L  
>U0707056| codons 16-239
MDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPIFAIKKKNSTRWRKLV
DFRELNKRTQDFWEVQLGIPHPGGLHKKKSVTVLDVGDAYFSIPLHESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRIKNPELVICQYVDDLYVGSDLEI
GQHRTKIEELRAHLLSWGLYTPDEKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013