<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R V75T, K219R K103KN, Y181C, G190A   V35T, T39E, S68G, T69X, V106I, K122E, D123S, I132L, I142V, K173I, Q174K, D177E, I178IM, V179I, Q207A, R211S, F214L, H221Y, L228LR, K238R I63L, P140T
>Q0915090| codons 23-239
QWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFALKRKDGXKWRKLTDFRELNK
RTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPLDESFRKYTAFTLPSINNETTGV
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMIICQYMDDLYVASDLEIGQHRTKI
EELRAHLLSWGLTTPDRKYQKEPPFRWMGYELHPDRW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013