<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
S1117398 S1117398 Cambodia 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V D67E, V75M, K219R Y181C, G190A   V35T, E36R, T39A, E40D, K46Q, S68N, K101Q, K103R, K122E, I132L, S162C, K173I, Q174R, D177E, T200A, Q207A, R211S K64T, K66D
>S1117398| codons 23-239
QWPLTEEKIKALTRICADMEKEGQISKIGPENPYNTPVFAITRDENTKWRKLMDFRELNK
RTQDFWEVQLGIPHPAGLQKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTLPSINNETPGI
RYQYNVLPQGWKGSPAIFQCSMTKILEPFRIRNPEIVICQYVDDLYVASDLEIGQHRAKI
EELRAHLLSWGFTTPDRKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013