<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03-0012 03-0012 Cambodia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I K101P, K103N   V35T, T39K, K43E, K122E, D123S, K173IL, Q174KR, D177E, I178L, V179I, T200A, Q207A, R211S, K238R  
>03-0012| codons 16-239
MDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLRNPELIIYQYVDDLYVGSDLEI
GQHRAKIEELRAHLLSWGFITPDKKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013